PNC-27

AUD163

Last Sold  18 sold in last 3 hours
  Hurry up! Sale end in:
+ -
  •  Delivery & Return

    Delivery

    We ship to all 50 states, Washington DC. All orders are shipped with a UPS /FEDEX tracking number. Always free shipping for orders over US $100. During sale periods and promotions the delivery time may be longer than normal.

    Return

    To maintain the highest standards of analytical transparency and product safety, we do not accept returns. We are committed to accurate order fulfillment and support; please contact our team prior to purchasing if you have questions regarding specifications. While we do not accept returns on research compounds, if you receive an incorrect item or your package arrives damaged, please contact our support team within 48 hours of delivery for a prompt resolution.

    Help

    Give us a shout if you have any other questions and/or concerns. Email: info@purerawzsupplier.com Phone: +1 (23) 456 789
  Estimated Delivery: Jul 06 – Jul 08
  ... people are viewing this right now

  Share

Buy PNC-27 online | PNC-27 for sale

PNC-27 is a synthetic peptide. It is designed to copy a domain of the tumor suppressor p53 protein. It induces a membrane-localizing leader sequence enabling interaction with cellular membranes. In research contexts, PNC-27 is used to investigate the following:

  • peptide-induced membrane perturbation
  • selective disruption of malignant cell membranes
  • and mechanisms of peptide-mediated apoptosis in cultured cells.

Chemical and Molecular Properties

Property Description
Compound Name PNC-27
Peptide Sequence H-RKKRRQRRRGLFGTPVDGHSERRVRSVRTRVLSQLR-NH2
Molecular Type Synthetic peptide
Amino Acid Length 30 amino acids
Molecular Weight ~3526 Da
Structural Class p53-derived membrane-active peptide
Mechanistic Classification Peptide investigational compound
Research Use In vitro cellular and membrane studies

Working Mechanism of PNC-27

Membrane Targeting via Leader Sequence

PNC-27 contains a membrane-localizing sequence. It is derived from a functional protein domain that facilitates association with lipid bilayers in controlled experimental systems. This structural design enables researchers to investigate peptide–membrane interactions under in vitro conditions.

Interaction with Membrane-Associated Proteins

In laboratory models, PNC-27 has been evaluated for its interaction with membrane-associated protein domains. These are expressed in specific cultured cell lines. These studies focus on characterizing peptide binding dynamics, structural association, and downstream biochemical responses within controlled cellular environments.

Membrane Integrity and Cellular Response Signaling

Experimental data suggest that PNC-27 may induce membrane perturbation in select cell models. This leads to alterations in membrane stability and activation of intracellular signaling pathways associated with programmed cell response mechanisms. These observations are used to study peptide-induced cellular responses in vitro.

All mechanistic descriptions above are derived from controlled laboratory investigations and do not imply clinical relevance or therapeutic application.

PNC-27 Research Applications (Laboratory Use Only)

  • In vitro membrane interaction assays using peptide models
  • Mechanistic studies of peptide-induced signaling and cellular responses
  • Experimental analysis of apoptosis-linked pathways in cultured cells
  • Cell morphology and membrane integrity investigations in oncology research models

These applications are strictly limited to laboratory research contexts.

Why Choose Purerawz for PNC-27?

Buy PNC-27 for laboratory research use from our online shop. At Purerawz, we provide high-quality reference materials. Each research compound comes with a Certificate of Analysis for verification of purity and concentration.

Note: PNC-27 (synthetic peptide investigational compound) is an investigational compound currently undergoing scientific evaluation and has not been established as safe or effective for any therapeutic use.

Disclaimer

This information is for educational purposes only and not medical advice. Products are for research use only. Research must follow IRB or IACUC guidelines. Verify information independently before purchasing. By ordering, you agree to our Terms and Conditions.

ATTENTION: All our products are for LABORATORY AND RESEARCH PURPOSES ONLY, not for veterinary or human use.

Strength

5mg

Based on 0 reviews

0.00 Overall
0%
0%
0%
0%
0%
Be the first to review “PNC-27”

Your email address will not be published. Required fields are marked *

Reviews

There are no reviews yet.

Close My Cart
Close Wishlist
Recently Viewed Close
Close

Close
Navigation
Categories
Newsletter

Newsletter

Be the first to know about our new arrivals, exclusive offers and the latest Compounds update.


    Select at least 2 products
    to compare