PNC-27
AUD163
Buy PNC-27 online | PNC-27 for sale
PNC-27 is a synthetic peptide. It is designed to copy a domain of the tumor suppressor p53 protein. It induces a membrane-localizing leader sequence enabling interaction with cellular membranes. In research contexts, PNC-27 is used to investigate the following:
- peptide-induced membrane perturbation
- selective disruption of malignant cell membranes
- and mechanisms of peptide-mediated apoptosis in cultured cells.
Chemical and Molecular Properties
| Property | Description |
| Compound Name | PNC-27 |
| Peptide Sequence | H-RKKRRQRRRGLFGTPVDGHSERRVRSVRTRVLSQLR-NH2 |
| Molecular Type | Synthetic peptide |
| Amino Acid Length | 30 amino acids |
| Molecular Weight | ~3526 Da |
| Structural Class | p53-derived membrane-active peptide |
| Mechanistic Classification | Peptide investigational compound |
| Research Use | In vitro cellular and membrane studies |
Working Mechanism of PNC-27
Membrane Targeting via Leader Sequence
PNC-27 contains a membrane-localizing sequence. It is derived from a functional protein domain that facilitates association with lipid bilayers in controlled experimental systems. This structural design enables researchers to investigate peptide–membrane interactions under in vitro conditions.
Interaction with Membrane-Associated Proteins
In laboratory models, PNC-27 has been evaluated for its interaction with membrane-associated protein domains. These are expressed in specific cultured cell lines. These studies focus on characterizing peptide binding dynamics, structural association, and downstream biochemical responses within controlled cellular environments.
Membrane Integrity and Cellular Response Signaling
Experimental data suggest that PNC-27 may induce membrane perturbation in select cell models. This leads to alterations in membrane stability and activation of intracellular signaling pathways associated with programmed cell response mechanisms. These observations are used to study peptide-induced cellular responses in vitro.
All mechanistic descriptions above are derived from controlled laboratory investigations and do not imply clinical relevance or therapeutic application.
PNC-27 Research Applications (Laboratory Use Only)
- In vitro membrane interaction assays using peptide models
- Mechanistic studies of peptide-induced signaling and cellular responses
- Experimental analysis of apoptosis-linked pathways in cultured cells
- Cell morphology and membrane integrity investigations in oncology research models
These applications are strictly limited to laboratory research contexts.
Why Choose Purerawz for PNC-27?
Buy PNC-27 for laboratory research use from our online shop. At Purerawz, we provide high-quality reference materials. Each research compound comes with a Certificate of Analysis for verification of purity and concentration.
Note: PNC-27 (synthetic peptide investigational compound) is an investigational compound currently undergoing scientific evaluation and has not been established as safe or effective for any therapeutic use.
Disclaimer
This information is for educational purposes only and not medical advice. Products are for research use only. Research must follow IRB or IACUC guidelines. Verify information independently before purchasing. By ordering, you agree to our Terms and Conditions.
ATTENTION: All our products are for LABORATORY AND RESEARCH PURPOSES ONLY, not for veterinary or human use.
| Strength | 5mg |
|---|
















Reviews
There are no reviews yet.